4.75 Rating by CuteStat

paulirish.com is 1 decade 6 years old. It is a domain having com extension. It has a global traffic rank of #310632 in the world. This website is estimated worth of $ 28,620.00 and have a daily income of around $ 53.00. As no active threats were reported recently by users, paulirish.com is SAFE to browse.

PageSpeed Score
90
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 4,742
Daily Pageviews: 18,968

Estimated Valuation

Income Per Day: $ 53.00
Estimated Worth: $ 28,620.00

Search Engine Indexes

Google Indexed Pages: 452
Bing Indexed Pages: 21,400

Search Engine Backlinks

Google Backlinks: 250,000
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 310,632
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.28.23.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 5 H2 Headings: 3
H3 Headings: Not Applicable H4 Headings: 10
H5 Headings: 2 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 6
Google Adsense: Not Applicable Google Analytics: UA-692547-2

Websites Hosted on Same IP (i.e. 104.28.23.33)


سهامداران پدیده شاندیز و پدیده کیش

- shandizstocks.ir

سایت سهامداران پدیده شاندیز و پدیده کیش به همراه آخرین اخبار درباره پروژه های شرکت پدیده شاندیز محلی مناسب برای تمام افرای که سهام پدیده شاندیز را دارند

30,640 $ 271,440.00

uevf.org: SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Paras

- uevf.org

Get the Latest News, updates, publications and the newest posts from sources uevf.org. SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Parasite,' These Are the Ones to Beat

Not Applicable $ 8.95

Traffic Ticket Attorneys | York & Lancaster, PA | 717 889 7100

- centralpennsylvaniatrafficlawyers.com

Fight That Traffic Ticket! Whether it is a Speeding Ticket or another violation our experienced traffic lawyers will protect your right to drive and right to work

Not Applicable $ 8.95

Aruba | Aruba Airlines

- arubaairlines.com
2,048,726 $ 720.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 11 Dec 2019 00:23:02 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Thu, 18 Apr 2019 23:20:04 GMT
Vary: Accept-Encoding
Content-Security-Policy: default-src 'self'; script-src 'self' 'unsafe-inline' https://ssl.google-analytics.com https://api.github.com https://disqus.com https://go.disqus.com https://*.disquscdn.com https://www.google-analytics.com https://paulirish.disqus.com https://platform.twitter.com https://cdn.syndication.twimg.com https://ajax.googleapis.com; style-src 'self' 'unsafe-inline' https://fonts.googleapis.com https://platform.twitter.com https://c.disquscdn.com; img-src * 'self' data:; font-src 'self' data: https://fonts.gstatic.com; connect-src 'self' https://firebaseremoteconfig.googleapis.com https://firebaseinstallations.googleapis.com ttps://firebaseremoteconfig.googleapis.com https://firebaselogging.googleapis.com; object-src http://vimeo.com http://static.slidesharecdn.com; frame-src 'self' https://platform.twitter.com https://accounts.google.com https://player.vimeo.com https://www.youtube.com https://apis.google.com https://disqus.com https://paulirish.wufoo.com http://jsfiddle.net http://player.vimeo.com https://staticxx.facebook.com https://syndication.twitter.com; worker-src 'self' blob:; upgrade-insecure-requests; report-uri https://paulirish.report-uri.com/r/d/csp/enforce
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 54334ebd6e4e2880-SJC
Content-Encoding: gzip

Domain Information

Domain Registrar: Squarespace Domains II LLC
Registration Date: Aug 2, 2007, 2:45 PM 1 decade 6 years 8 months ago
Expiration Date: Aug 2, 2020, 2:45 PM 3 years 8 months 2 weeks ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
lara.ns.cloudflare.com 108.162.192.128 United States of America United States of America
todd.ns.cloudflare.com 108.162.193.146 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
paulirish.com A 300 IP: 104.28.22.33
paulirish.com A 300 IP: 104.28.23.33
paulirish.com NS 86400 Target: todd.ns.cloudflare.com
paulirish.com NS 86400 Target: lara.ns.cloudflare.com
paulirish.com SOA 3600 MNAME: lara.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2032736769
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
paulirish.com MX 300 Target: mx2.balanced.homie.mail.dreamhost.com
paulirish.com MX 300 Target: mx1.balanced.homie.mail.dreamhost.com
paulirish.com AAAA 300 IPV6: 2606:4700:30::681c:1621
paulirish.com AAAA 300 IPV6: 2606:4700:30::681c:1721

Similarly Ranked Websites

Paciolan – Your tickets, your way.

- evenue.asia
310,633 $ 16,200.00

Free vectors, photos and icons | CannyPic

- cannypic.com

Exclusive free vectors, photos and icons from CannyPic. Best freebies

310,633 $ 28,620.00

Onlinearchiv | Österreichische Mediathek

- mediathek.at
310,634 $ 28,620.00

Supply Chain Consulting | Operations Management

- operationconsultinggroup.com

Management Consulting Services including supply chain and operations management. Specialized in Manufacturing, Healthcare, Retail, and Small Businesses

310,634 $ 16,200.00

Free Back Links

- weberlinks.com

Free back links with one click. Submit your site for an instant free backlink.

310,635 $ 16,200.00

Full WHOIS Lookup

Domain Name: paulirish.com
Registry Domain ID: 1125947660_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.google.com
Registrar URL: https://domains.google.com
Updated Date: 2019-08-02T12:44:14Z
Creation Date: 2007-08-02T09:00:15Z
Registrar Registration Expiration Date: 2020-08-02T09:00:15Z
Registrar: Google LLC
Registrar IANA ID: 895
Registrar Abuse Contact Email: registrar-abuse@google.com
Registrar Abuse Contact Phone: +1.8772376466
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Contact Privacy Inc. Customer 1242599513
Registrant Organization: Contact Privacy Inc. Customer 1242599513
Registrant Street: 96 Mowat Ave
Registrant City: Toronto
Registrant State/Province: ON
Registrant Postal Code: M4K 3K1
Registrant Country: CA
Registrant Phone: +1.4165385487
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: hmi4hkm6aalb@contactprivacy.email
Registry Admin ID:
Admin Name: Contact Privacy Inc. Customer 1242599513
Admin Organization: Contact Privacy Inc. Customer 1242599513
Admin Street: 96 Mowat Ave
Admin City: Toronto
Admin State/Province: ON
Admin Postal Code: M4K 3K1
Admin Country: CA
Admin Phone: +1.4165385487
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: hmi4hkm6aalb@contactprivacy.email
Registry Tech ID:
Tech Name: Contact Privacy Inc. Customer 1242599513
Tech Organization: Contact Privacy Inc. Customer 1242599513
Tech Street: 96 Mowat Ave
Tech City: Toronto
Tech State/Province: ON
Tech Postal Code: M4K 3K1
Tech Country: CA
Tech Phone: +1.4165385487
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: hmi4hkm6aalb@contactprivacy.email
Name Server: LARA.NS.CLOUDFLARE.COM
Name Server: TODD.NS.CLOUDFLARE.COM
DNSSEC: signedDelegation
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-11T00:22:11Z <<<

For more information on Whois status codes, please visit
https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Please register your domains at: https://domains.google.com/
This data is provided by Google for information purposes, and to assist
persons obtaining information about or related to domain name registration
records. Google does not guarantee its accuracy.
By submitting a WHOIS query, you agree that you will use this data only for
lawful purposes and that, under no circumstances, will you use this data to:
1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via E-mail (spam); or
2) enable high volume, automated, electronic processes that apply to this
WHOIS server.
These terms may be changed without prior notice.
By submitting this query, you agree to abide by this policy.